EmojiHexa
🤴🏽

person-role

Prince: Medium Skin Tone

1F934 1F3FD · U+1F934 U+1F3FD · 🤴🏽

What it means

The Prince: Medium Skin Tone emoji 🤴🏽 is used around ideas like crown, fairy, fairytale, fantasy and king.

Emoji render in the viewer’s own font, so the exact drawing differs between Apple, Google, Samsung and Microsoft — the sense above is what stays constant.

Choose a skin tone

🤴🤴🏻🤴🏼🤴🏽🤴🏾🤴🏿

Keywords

Search terms recorded for this emoji in Unicode CLDR.

crownfairyfairytalefantasykingmedium skin toneprinceroyalroyaltytale

Details

Hexa1F934 1F3FD
CodepointsU+1F934 U+1F3FD
HTML (hex)🤴🏽
HTML (decimal)🤴🏽
CLDR short nameprince: medium skin tone
Emoji versionEmoji 3.0 · 2016 →
Qualificationfully-qualified
CategoryPeople & Body
Subcategoryperson-role
Sequence typeSkin-tone sequence

Timeline

  1. Emoji 3.0 · 2016Prince: Medium Skin Tone entered the standard as U+1F934 U+1F3FD, establishing the codepoint still used today.
  2. TodayRendered across major platforms. Apple, Google, Microsoft and Samsung each draw it in their own style while preserving the same underlying character.

More from Emoji 3.0

See all →
🤣Rolling On The Floor Laughing🤥Lying Face🤤Drooling Face🤢Nauseated Face🤧Sneezing Face🤠Cowboy Hat Face🤡Clown Face🖤Black Heart

Related emoji

Ranked by shared meaning, not by codepoint order.

🤴Prince👸Princess😇Smiling Face With Halo😈Smiling Face With Horns👿Angry Face With Horns👹Ogre👺Goblin👻Ghost👽Alien👾Alien Monster👼Baby Angel🧚Fairy

Keep exploring

🤴🏽All person-roleBrowse the subgroup◆People & BodyBrowse the full category🧭Explore everythingEvery category and subgroup
🤴🏽 Prince: Medium Skin Tone | EmojiHexa